PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011887m
Common NameCARUB_v10011887mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 360aa    MW: 41535.1 Da    PI: 6.9211
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011887mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74e-1698143147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v  +G+ +W++Ia++++ gR++k+c++rw++ 
  Carubv10011887m  98 RGHWRPAEDVKLKELVSIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 143
                      899*****************************.***********996 PP

2Myb_DNA-binding591.1e-18150193146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
  Carubv10011887m 150 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 193
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0893144IPR017930Myb domain
SMARTSM007176.5E-1497146IPR001005SANT/Myb domain
PfamPF002491.2E-1598143IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-2898191IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-2599151IPR009057Homeodomain-like
CDDcd001671.43E-11101142No hitNo description
PROSITE profilePS5129427.451145199IPR017930Myb domain
SMARTSM007178.2E-15149197IPR001005SANT/Myb domain
PfamPF002491.5E-15150192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-21152198IPR009057Homeodomain-like
CDDcd001674.34E-11152192No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MFITEKQLWM DEIAARRASS SSWDFPFNDI NIHQQRHCNT SHEFEILKTS LGDVSAHEEE  60
SNTHNPNFSN SESGNKKETT DSGQSWSSSS SKPSTLGRGH WRPAEDVKLK ELVSIYGPQN  120
WNLIAEKLQG RSGKSCRLRW FNQLDPRIHR RAFTEEEEER LMQAHRLYGN KWAMIARLFP  180
GRTDNSVKNH WHVIMARKYR EHSSAYRRRK LMNNNPLKTH LPNNHHPNPN PNYHSFLSTN  240
HYFAQPFPEF NLAHHLVNNA PITSDQNQLV FPFHCFQGYE SNDTPMVVSM FSNQMMVADN  300
VGATSDALYW NGSQGKEELD HEPMHWIGME AVDEEVVEKA KQQPHYFDFL GLGTAASES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31961985107B-MYB
1h88_C6e-319619856158MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-319619856158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348160.0AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds.
GenBankAY5195590.0AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ4462910.0DQ446291.1 Arabidopsis thaliana clone pENTR221-At1g26780 myb family transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ6528620.0DQ652862.1 Arabidopsis thaliana clone 0000017266_0000012084 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303738.10.0hypothetical protein CARUB_v10011887mg
TrEMBLR0GLJ00.0R0GLJ0_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10022870.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.20.0myb domain protein 117